Lineage for d3zuca_ (3zuc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771715Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1771831Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 1771832Protein automated matches [191113] (6 species)
    not a true protein
  7. 1771833Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)
  8. 1771834Domain d3zuca_: 3zuc A: [186574]
    automated match to d1nbca_
    complexed with 1pe, ca, edo, ni

Details for d3zuca_

PDB Entry: 3zuc (more details), 1 Å

PDB Description: structure of cbm3b of major scaffoldin subunit scaa from acetivibrio cellulolyticus determined from the crystals grown in the presence of nickel
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d3zuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zuca_ b.2.2.0 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
gshmnlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcd
wspvgssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynq
addysfnssattytswdkvtaysaegliwgiep

SCOPe Domain Coordinates for d3zuca_:

Click to download the PDB-style file with coordinates for d3zuca_.
(The format of our PDB-style files is described here.)

Timeline for d3zuca_: