SCOPe 2.05: Domain d3zu8a_: 3zu8 A:

Lineage for d3zu8a_ (3zu8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)

8. Domain d3zu8a_: 3zu8 A: [186573]
   automated match to d1nbca_
   complexed with 1pe, ca, edo, ni

Details for d3zu8a_

PDB Entry: 3zu8, 1.8 Å

PDB Description: structure of cbm3b of major scaffoldin subunit scaa from acetivibrio cellulolyticus determined on the nikel absorption edge

PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d3zu8a_:

Sequence; same for both SEQRES and ATOM records:

>d3zu8a_ b.2.2.0 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
gshmnlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcd
wspvgssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynq
addysfnssattytswdkvtaysaegliwgiep

Timeline for d3zu8a_:

• d3zu8a_ first appeared in SCOPe 2.01
  
• d3zu8a_ appears in SCOPe 2.04
  
• d3zu8a_ is called d3zu8a1 in SCOPe 2.06
  
• d3zu8a_ appears in the current release, SCOPe 2.08, called d3zu8a1