SCOPe 2.01: Domain d3ztza_: 3ztz A:

Lineage for d3ztza_ (3ztz A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)

6. Protein automated matches [190363] (3 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [189489] (22 PDB entries)

8. Domain d3ztza_: 3ztz A: [186572]
   automated match to d1e83a_
   complexed with cmo, hec

Details for d3ztza_

PDB Entry: 3ztz, 1.05 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.05 a resolution: unrestraint refinement

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d3ztza_:

Sequence; same for both SEQRES and ATOM records:

>d3ztza_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrk

Timeline for d3ztza_:

• d3ztza_ is new in SCOPe 2.01-stable
  
• d3ztza_ appears in SCOPe 2.02
  
• d3ztza_ appears in the current release, SCOPe 2.08