Lineage for d3ztza_ (3ztz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699842Protein automated matches [190363] (5 species)
    not a true protein
  7. 2699843Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries)
  8. 2699854Domain d3ztza_: 3ztz A: [186572]
    automated match to d1e83a_
    complexed with cmo, hec

Details for d3ztza_

PDB Entry: 3ztz (more details), 1.05 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.05 a resolution: unrestraint refinement
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d3ztza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ztza_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrk

SCOPe Domain Coordinates for d3ztza_:

Click to download the PDB-style file with coordinates for d3ztza_.
(The format of our PDB-style files is described here.)

Timeline for d3ztza_: