![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries) |
![]() | Domain d3ztxa_: 3ztx A: [186570] automated match to d1ol5a_ complexed with ztx |
PDB Entry: 3ztx (more details), 1.95 Å
SCOPe Domain Sequences for d3ztxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztxa_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry hppqrlplkgvmehpwvkansrrvlppvyq
Timeline for d3ztxa_: