| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (2 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) |
| Protein automated matches [190363] (3 species) not a true protein |
| Species Achromobacter xylosoxidans [TaxId:85698] [189489] (22 PDB entries) |
| Domain d3ztma_: 3ztm A: [186565] automated match to d1e83a_ complexed with cmo, hec |
PDB Entry: 3ztm (more details), 0.9 Å
SCOPe Domain Sequences for d3ztma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztma_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk
Timeline for d3ztma_: