Lineage for d3ztma_ (3ztm A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 909895Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 910016Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
  6. 910053Protein automated matches [190363] (3 species)
    not a true protein
  7. 910054Species Achromobacter xylosoxidans [TaxId:85698] [189489] (22 PDB entries)
  8. 910058Domain d3ztma_: 3ztm A: [186565]
    automated match to d1e83a_
    complexed with cmo, hec

Details for d3ztma_

PDB Entry: 3ztm (more details), 0.9 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution: unrestraint refinement
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d3ztma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ztma_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

SCOPe Domain Coordinates for d3ztma_:

Click to download the PDB-style file with coordinates for d3ztma_.
(The format of our PDB-style files is described here.)

Timeline for d3ztma_: