SCOPe 2.08: Domain d3ztma_: 3ztm A:

Lineage for d3ztma_ (3ztm A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (5 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries)

8. Domain d3ztma_: 3ztm A: [186565]
   automated match to d1e83a_
   complexed with cmo, hec

Details for d3ztma_

PDB Entry: 3ztm, 0.9 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution: unrestraint refinement

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d3ztma_:

Sequence; same for both SEQRES and ATOM records:

>d3ztma_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsagtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

Timeline for d3ztma_:

• d3ztma_ first appeared in SCOPe 2.01
  
• d3ztma_ appears in SCOPe 2.07