Lineage for d1aeva_ (1aev A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002485Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2002486Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2002646Domain d1aeva_: 1aev A: [18656]
    complexed with amt, hem

Details for d1aeva_

PDB Entry: 1aev (more details), 2.1 Å

PDB Description: introduction of novel substrate oxidation into cytochrome c peroxidase by cavity complementation: oxidation of 2-aminothiazole and covalent modification of the enzyme (2-aminothiazole)
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1aeva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeva_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1aeva_:

Click to download the PDB-style file with coordinates for d1aeva_.
(The format of our PDB-style files is described here.)

Timeline for d1aeva_: