SCOPe 2.02: Domain d1aema_: 1aem A:

Lineage for d1aema_ (1aem A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (145 PDB entries)
   Uniprot P00431

8. Domain d1aema_: 1aem A: [18654]
   complexed with hem, mpi

Details for d1aema_

PDB Entry: 1aem, 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (imidazo[1,2-a]pyridine)

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1aema_:

Sequence; same for both SEQRES and ATOM records:

>d1aema_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aema_:

• d1aema_ first appeared (with stable ids) in SCOP 1.55, called d1aem__
  
• d1aema_ appears in SCOPe 2.01
  
• d1aema_ appears in SCOPe 2.03
  
• d1aema_ appears in the current release, SCOPe 2.08