Lineage for d3zr7a_ (3zr7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342597Domain d3zr7a_: 3zr7 A: [186527]
    automated match to d1a28a_
    complexed with gol, or8, so4

Details for d3zr7a_

PDB Entry: 3zr7 (more details), 1.65 Å

PDB Description: structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d3zr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zr7a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d3zr7a_:

Click to download the PDB-style file with coordinates for d3zr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3zr7a_: