![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
![]() | Domain d3zr7a_: 3zr7 A: [186527] automated match to d1a28a_ complexed with gol, or8, so4 |
PDB Entry: 3zr7 (more details), 1.65 Å
SCOPe Domain Sequences for d3zr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zr7a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila gmvkpllfhk
Timeline for d3zr7a_: