Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (12 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries) |
Domain d3zqwa1: 3zqw A:5-153 [186520] Other proteins in same PDB: d3zqwa2 automated match to d1nbca_ complexed with 1pe, ca, edo, ni |
PDB Entry: 3zqw (more details), 1.07 Å
SCOPe Domain Sequences for d3zqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zqwa1 b.2.2.0 (A:5-153) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} nlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcdwspv gssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynqaddy sfnssattytswdkvtaysaegliwgiep
Timeline for d3zqwa1: