| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) ![]() |
| Family c.34.1.0: automated matches [191535] (1 protein) not a true family |
| Protein automated matches [190910] (10 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189793] (14 PDB entries) |
| Domain d3zqua_: 3zqu A: [186518] automated match to d1sbza_ complexed with fnr, so4 |
PDB Entry: 3zqu (more details), 1.5 Å
SCOPe Domain Sequences for d3zqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zqua_ c.34.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
fvvarilntlgipqdmlprwgeqhlvs
Timeline for d3zqua_: