Lineage for d3zqta_ (3zqt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729655Species Escherichia coli [TaxId:469008] [189841] (1 PDB entry)
  8. 2729656Domain d3zqta_: 3zqt A: [186517]
    automated match to d1e3ga_
    complexed with 30z, so4, tes

Details for d3zqta_

PDB Entry: 3zqt (more details), 2.29 Å

PDB Description: targeting the binding function 3 site of the androgen receptor through in silico molecular modeling
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3zqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zqta_ a.123.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfhtq

SCOPe Domain Coordinates for d3zqta_:

Click to download the PDB-style file with coordinates for d3zqta_.
(The format of our PDB-style files is described here.)

Timeline for d3zqta_: