SCOPe 2.07: Domain d3vlwb_: 3vlw B:

Lineage for d3vlwb_ (3vlw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Sphingomonas sp. [TaxId:90322] [186866] (5 PDB entries)

8. Domain d3vlwb_: 3vlw B: [186516]
   automated match to d1j1na_
   complexed with ca, gol

Details for d3vlwb_

PDB Entry: 3vlw, 2 Å

PDB Description: crystal structure of sphingomonas sp. a1 alginate-binding protein algq1 in complex with mannuronate-guluronate disaccharide

PDB Compounds: (B:) AlgQ1

SCOPe Domain Sequences for d3vlwb_:

Sequence; same for both SEQRES and ATOM records:

>d3vlwb_ c.94.1.1 (B:) automated matches {Sphingomonas sp. [TaxId: 90322]}
eatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnlm
masgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitapd
gniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkadei
pfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwykeg
lidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinskg
qrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngkp
vykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpqf
tgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmiv
mqkaydrqy

Timeline for d3vlwb_:

• d3vlwb_ first appeared in SCOPe 2.01
  
• d3vlwb_ appears in SCOPe 2.06
  
• d3vlwb_ appears in the current release, SCOPe 2.08