Lineage for d3vj7a_ (3vj7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614458Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 2614459Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 2614466Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins)
  6. 2614467Protein Colicin E5 [143008] (1 species)
  7. 2614468Species Escherichia coli [TaxId:562] [143009] (4 PDB entries)
    Uniprot P18000 84-177
  8. 2614476Domain d3vj7a_: 3vj7 A: [186512]
    automated match to d2a8ka1
    complexed with 3pd, um3; mutant

Details for d3vj7a_

PDB Entry: 3vj7 (more details), 2.3 Å

PDB Description: Crystal structure of the carboxy-terminal ribonuclease domain of Colicin E5 R33Q mutant
PDB Compounds: (A:) Colicin-E5

SCOPe Domain Sequences for d3vj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vj7a_ d.243.1.2 (A:) Colicin E5 {Escherichia coli [TaxId: 562]}
pglkidqkirgqmpeqgwteddikntvsngatgtsfdkrspkktppdylgrndpatvygs
pgkyvvvndrtgevtqisdktdpgwvddsriqwg

SCOPe Domain Coordinates for d3vj7a_:

Click to download the PDB-style file with coordinates for d3vj7a_.
(The format of our PDB-style files is described here.)

Timeline for d3vj7a_: