SCOPe 2.05: Domain d3vhmc_: 3vhm C:

Lineage for d3vhmc_ (3vhm C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (25 PDB entries)

8. Domain d3vhmc_: 3vhm C: [186509]
   automated match to d1rava_
   complexed with nag, npk, so4

Details for d3vhmc_

PDB Entry: 3vhm, 2 Å

PDB Description: crystal structure of npc-biotin-avidin complex

PDB Compounds: (C:) Avidin

SCOPe Domain Sequences for d3vhmc_:

Sequence; same for both SEQRES and ATOM records:

>d3vhmc_ b.61.1.1 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

Timeline for d3vhmc_:

• d3vhmc_ first appeared in SCOPe 2.01
  
• d3vhmc_ appears in SCOPe 2.04
  
• d3vhmc_ appears in SCOPe 2.06
  
• d3vhmc_ appears in the current release, SCOPe 2.08