SCOPe 2.04: Domain d3vhhc_: 3vhh C:

Lineage for d3vhhc_ (3vhh C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (24 PDB entries)

8. Domain d3vhhc_: 3vhh C: [186501]
   automated match to d1rava_
   complexed with nag, so4, vhh

Details for d3vhhc_

PDB Entry: 3vhh, 2.26 Å

PDB Description: crystal structure of dime-biotin-avidin complex

PDB Compounds: (C:) Avidin

SCOPe Domain Sequences for d3vhhc_:

Sequence; same for both SEQRES and ATOM records:

>d3vhhc_ b.61.1.1 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

Timeline for d3vhhc_:

• d3vhhc_ first appeared in SCOPe 2.01
  
• d3vhhc_ appears in SCOPe 2.03
  
• d3vhhc_ appears in SCOPe 2.05
  
• d3vhhc_ appears in the current release, SCOPe 2.08