SCOPe 2.06: Domain d3vhhb_: 3vhh B:

Lineage for d3vhhb_ (3vhh B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d3vhhb_: 3vhh B: [186500]
   automated match to d1rava_
   complexed with nag, so4, vhh

Details for d3vhhb_

PDB Entry: 3vhh, 2.26 Å

PDB Description: crystal structure of dime-biotin-avidin complex

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d3vhhb_:

Sequence; same for both SEQRES and ATOM records:

>d3vhhb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d3vhhb_:

• d3vhhb_ first appeared in SCOPe 2.01
  
• d3vhhb_ appears in SCOPe 2.05
  
• d3vhhb_ appears in SCOPe 2.07
  
• d3vhhb_ appears in the current release, SCOPe 2.08