Lineage for d1aeg__ (1aeg -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49665Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 49672Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 49673Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (71 PDB entries)
  8. 49726Domain d1aeg__: 1aeg - [18650]

Details for d1aeg__

PDB Entry: 1aeg (more details), 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (4-aminopyridine)

SCOP Domain Sequences for d1aeg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeg__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1aeg__:

Click to download the PDB-style file with coordinates for d1aeg__.
(The format of our PDB-style files is described here.)

Timeline for d1aeg__: