Lineage for d3vh4b_ (3vh4 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018108Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
  6. 1018130Protein automated matches [190358] (5 species)
    not a true protein
  7. 1018147Species Saccharomyces cerevisiae [TaxId:559292] [189812] (3 PDB entries)
  8. 1018150Domain d3vh4b_: 3vh4 B: [186496]
    automated match to d1eo6a_
    complexed with atp, mg, zn

Details for d3vh4b_

PDB Entry: 3vh4 (more details), 2.65 Å

PDB Description: Crystal structure of Atg7CTD-Atg8-MgATP complex
PDB Compounds: (B:) Autophagy-related protein 8

SCOPe Domain Sequences for d3vh4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vh4b_ d.15.1.3 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg

SCOPe Domain Coordinates for d3vh4b_:

Click to download the PDB-style file with coordinates for d3vh4b_.
(The format of our PDB-style files is described here.)

Timeline for d3vh4b_: