Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins |
Protein automated matches [190358] (5 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [189812] (3 PDB entries) |
Domain d3vh4b_: 3vh4 B: [186496] automated match to d1eo6a_ complexed with atp, mg, zn |
PDB Entry: 3vh4 (more details), 2.65 Å
SCOPe Domain Sequences for d3vh4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vh4b_ d.15.1.3 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
Timeline for d3vh4b_: