Lineage for d3vgwg_ (3vgw G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1801148Protein automated matches [190191] (2 species)
    not a true protein
  7. 1801149Species Chicken (Gallus gallus) [TaxId:9031] [186931] (25 PDB entries)
  8. 1801182Domain d3vgwg_: 3vgw G: [186493]
    automated match to d1rava_
    complexed with nag, nvz, so4

Details for d3vgwg_

PDB Entry: 3vgw (more details), 1.6 Å

PDB Description: crystal structure of monoac-biotin-avidin complex
PDB Compounds: (G:) Avidin

SCOPe Domain Sequences for d3vgwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgwg_ b.61.1.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

SCOPe Domain Coordinates for d3vgwg_:

Click to download the PDB-style file with coordinates for d3vgwg_.
(The format of our PDB-style files is described here.)

Timeline for d3vgwg_: