Lineage for d3vgwa_ (3vgw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415641Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2415670Domain d3vgwa_: 3vgw A: [186487]
    automated match to d1rava_
    complexed with nag, nvz, so4

Details for d3vgwa_

PDB Entry: 3vgw (more details), 1.6 Å

PDB Description: crystal structure of monoac-biotin-avidin complex
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d3vgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgwa_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

SCOPe Domain Coordinates for d3vgwa_:

Click to download the PDB-style file with coordinates for d3vgwa_.
(The format of our PDB-style files is described here.)

Timeline for d3vgwa_: