Lineage for d3vdia_ (3vdi A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402431Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2402432Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2402433Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2402443Protein automated matches [190386] (3 species)
    not a true protein
  7. 2402451Species Pelodictyon phaeum [TaxId:34091] [189887] (2 PDB entries)
  8. 2402452Domain d3vdia_: 3vdi A: [186486]
    automated match to d4bcla_
    complexed with bcl, pg4

Details for d3vdia_

PDB Entry: 3vdi (more details), 1.99 Å

PDB Description: Structure of the FMO protein from Pelodictyon phaeum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d3vdia_:

Sequence, based on SEQRES records: (download)

>d3vdia_ b.75.1.1 (A:) automated matches {Pelodictyon phaeum [TaxId: 34091]}
tttahsdyeiileggssswgqikgrakvnvpaalpllpadcnikieakpldaqkgvvrft
sqiesivdstknklvvevdianetkdrriavgegevsvgdfshkfsfegsvvnmyyyrsd
avrrnvpnpvymqgrqfhdimmkvpldnkdlietwegfqqsisgggvnfgdwirefwfig
paytaineggqrispiqvnnfgvesgekgpvgvsrwkfshagsgivdsisrwaelfpveq
lnkpasieggfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndf
tvdtqlkvvlpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

Sequence, based on observed residues (ATOM records): (download)

>d3vdia_ b.75.1.1 (A:) automated matches {Pelodictyon phaeum [TaxId: 34091]}
tttahsdyeiileggssswgqikgrakvnvpaalpllpadcnikieakpldaqkgvvrft
sqiesivdstknklvvevdianetkdrriavgegevsvgdfshkfsfegsvvnmyyyrsd
avrrnvpnpvymqgrqfhdimmkvpldnkdlietwegfqqsisgggvnfgdwirefwfig
paytaineggqrispiqvnnfgvesgpvgvsrwkfshagsgivdsisrwaelfpveqlnk
pasieggfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndftvd
tqlkvvlpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

SCOPe Domain Coordinates for d3vdia_:

Click to download the PDB-style file with coordinates for d3vdia_.
(The format of our PDB-style files is described here.)

Timeline for d3vdia_: