SCOPe 2.05: Domain d3vc7a_: 3vc7 A:

Lineage for d3vc7a_ (3vc7 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)

8. Domain d3vc7a_: 3vc7 A: [186484]
   automated match to d1nxqa_
   complexed with gol

Details for d3vc7a_

PDB Entry: 3vc7, 2.23 Å

PDB Description: Crystal Structure of a putative oxidoreductase from Sinorhizobium meliloti 1021

PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d3vc7a_:

Sequence, based on SEQRES records:

>d3vc7a_ c.2.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
nyqgkkaiviggthgmglatvrrlveggaevlltgrnesniarireefgprvhalrsdia
dlneiavlgaaagqtlgaidllhinagvselepfdqvseasydrqfavntkgafftvqrl
tplireggsivftssvadegghpgmsvysaskaalvsfasvlaaellprgirvnsvspgf
idtptkgvagiteaeraefktlgdnitpmkrngtadevaravlflafeatfttgaklavd
gglgqklst

Sequence, based on observed residues (ATOM records):

>d3vc7a_ c.2.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
nyqgkkaiviggthgmglatvrrlveggaevlltgrnesniarireefgprvhalrsdia
dlneiavlgaaagqtlgaidllhinagvselepfdqvseasydrqfavntkgafftvqrl
tplireggsivftssvadegghpgmsvysaskaalvsfasvlaaellprgirvnsvspgf
idtraefktlgdnitpmkrngtadevaravlflafeatfttgaklavdgglgqklst

Timeline for d3vc7a_:

• d3vc7a_ first appeared in SCOPe 2.01
  
• d3vc7a_ appears in SCOPe 2.04
  
• d3vc7a_ appears in SCOPe 2.06
  
• d3vc7a_ appears in the current release, SCOPe 2.08