SCOP 1.71: Domain d1aee__: 1aee -

Lineage for d1aee__ (1aee -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)

8. Domain d1aee__: 1aee - [18648]
   complexed with anl, hem; mutant

Details for d1aee__

PDB Entry: 1aee, 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (aniline)

SCOP Domain Sequences for d1aee__:

Sequence; same for both SEQRES and ATOM records:

>d1aee__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aee__:

• d1aee__ first appeared (with stable ids) in SCOP 1.55
  
• d1aee__ appears in SCOP 1.69
  
• d1aee__ is called d1aeea_ in SCOP 1.73
  
• d1aee__ appears in the current release, SCOPe 2.08, called d1aeea_