SCOPe 2.08: Domain d1aeea_: 1aee A:

Lineage for d1aeea_ (1aee A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
   Uniprot P00431

8. Domain d1aeea_: 1aee A: [18648]
   complexed with anl, hem

Details for d1aeea_

PDB Entry: 1aee, 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (aniline)

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1aeea_:

Sequence; same for both SEQRES and ATOM records:

>d1aeea_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aeea_:

• d1aeea_ first appeared (with stable ids) in SCOP 1.55, called d1aee__
  
• d1aeea_ appears in SCOPe 2.07