Lineage for d3v8za_ (3v8z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133793Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2133794Protein Glycogenin [75274] (2 species)
  7. 2133815Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (15 PDB entries)
  8. 2133825Domain d3v8za_: 3v8z A: [186467]
    automated match to d1ll0b_
    complexed with cl, gol, mn, udp

Details for d3v8za_

PDB Entry: 3v8z (more details), 2.2 Å

PDB Description: Structure of apo-glycogenin truncated at residue 270 complexed with UDP
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d3v8za_:

Sequence, based on SEQRES records: (download)

>d3v8za_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
thpqflnvwwdifttsvvpllqqf

Sequence, based on observed residues (ATOM records): (download)

>d3v8za_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrthpqflnv
wwdifttsvvpllqqf

SCOPe Domain Coordinates for d3v8za_:

Click to download the PDB-style file with coordinates for d3v8za_.
(The format of our PDB-style files is described here.)

Timeline for d3v8za_: