SCOP 1.67: Domain d1aeb__: 1aeb -

Lineage for d1aeb__ (1aeb -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (81 PDB entries)

8. Domain d1aeb__: 1aeb - [18646]
   complexed with 3mt, hem; mutant

Details for d1aeb__

PDB Entry: 1aeb, 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (3-methylthiazole)

SCOP Domain Sequences for d1aeb__:

Sequence; same for both SEQRES and ATOM records:

>d1aeb__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aeb__:

• d1aeb__ first appeared (with stable ids) in SCOP 1.55
  
• d1aeb__ appears in SCOP 1.65
  
• d1aeb__ appears in SCOP 1.69
  
• d1aeb__ appears in the current release, SCOPe 2.08, called d1aeba_