Lineage for d3v15c_ (3v15 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404719Family b.82.2.5: TauD/TfdA-like [75038] (5 protein domains)
    automatically mapped to Pfam PF02668
  6. 2404770Protein automated matches [191275] (2 species)
    not a true protein
  7. 2404779Species Pseudomonas putida [TaxId:160488] [189871] (3 PDB entries)
  8. 2404790Domain d3v15c_: 3v15 C: [186450]
    automated match to d1gqwb_

Details for d3v15c_

PDB Entry: 3v15 (more details), 2.6 Å

PDB Description: Crystal structure of the Fe(II)/alpha-ketoglutarate dependent taurine dioxygenase from Pseudomonas putida KT2440
PDB Compounds: (C:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d3v15c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v15c_ b.82.2.5 (C:) automated matches {Pseudomonas putida [TaxId: 160488]}
sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
dvafwdnrvtqhfavddyrpnrrvmhratilgdapf

SCOPe Domain Coordinates for d3v15c_:

Click to download the PDB-style file with coordinates for d3v15c_.
(The format of our PDB-style files is described here.)

Timeline for d3v15c_: