Lineage for d1ccja_ (1ccj A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. Domain d1ccja_: 1ccj A: [18644]
    complexed with hem

Details for d1ccja_

PDB Entry: 1ccj (more details), 2.1 Å

PDB Description: conformer selection by ligand binding observed with protein crystallography
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1ccja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccja_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnegylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1ccja_ are not available.

Timeline for d1ccja_: