Lineage for d3uyqa_ (3uyq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2812658Protein automated matches [190681] (2 species)
    not a true protein
  7. 2812668Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)
  8. 2812720Domain d3uyqa_: 3uyq A: [186435]
    automated match to d1flja_
    complexed with zn

Details for d3uyqa_

PDB Entry: 3uyq (more details), 1.7 Å

PDB Description: hca 3
PDB Compounds: (A:) Carbonic anhydrase 3

SCOPe Domain Sequences for d3uyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uyqa_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktiln
nghtcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
hwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdps
slfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplv
snwrppqpinnrvvrasfk

SCOPe Domain Coordinates for d3uyqa_:

Click to download the PDB-style file with coordinates for d3uyqa_.
(The format of our PDB-style files is described here.)

Timeline for d3uyqa_: