Lineage for d3uyoa_ (3uyo A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206888Protein automated matches [190202] (4 species)
    not a true protein
  7. 2206893Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2206899Domain d3uyoa_: 3uyo A: [186434]
    Other proteins in same PDB: d3uyod_
    automated match to d1ab2a_
    complexed with so4

Details for d3uyoa_

PDB Entry: 3uyo (more details), 1.83 Å

PDB Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3uyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uyoa_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhy
rintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygv

SCOPe Domain Coordinates for d3uyoa_:

Click to download the PDB-style file with coordinates for d3uyoa_.
(The format of our PDB-style files is described here.)

Timeline for d3uyoa_: