| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Campylobacter jejuni [TaxId:192222] [189366] (4 PDB entries) |
| Domain d3uy4a1: 3uy4 A:1-282 [186432] Other proteins in same PDB: d3uy4a2 automated match to d1v8fa_ complexed with amp, gol, pau |
PDB Entry: 3uy4 (more details), 1.85 Å
SCOPe Domain Sequences for d3uy4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uy4a1 c.26.1.0 (A:1-282) automated matches {Campylobacter jejuni [TaxId: 192222]}
mqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpmq
fgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgakr
pghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireedg
lakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklikidy
ielvdfntmenienitdnvlgavaafvgktrlidnflvqglk
Timeline for d3uy4a1: