Lineage for d3uved_ (3uve D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847681Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)
  8. 2847685Domain d3uved_: 3uve D: [186419]
    automated match to d1iy8a_
    complexed with edo, nad, pg4

Details for d3uved_

PDB Entry: 3uve (more details), 1.55 Å

PDB Description: crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
PDB Compounds: (D:) Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)

SCOPe Domain Sequences for d3uved_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uved_ c.2.1.0 (D:) automated matches {Mycobacterium avium [TaxId: 243243]}
tgrvegkvafvtgaargqgrshavrlaqegadiiavdickpiragvvdtaipastpedla
etadlvkghnrrivtaevdvrdydalkaavdsgveqlgrldiivanagignggdtldkts
eedwtemidinlagvwktvkagvphmiaggrggsiiltssvgglkayphtghyvaakhgv
vglmrafgvelgqhmirvnsvhpthvktpmlhnegtfkmfrpdlenpgpddmapicqmfh
tlpipwvepidisnavlffasdearyitgvtlpidagsclk

SCOPe Domain Coordinates for d3uved_:

Click to download the PDB-style file with coordinates for d3uved_.
(The format of our PDB-style files is described here.)

Timeline for d3uved_: