Lineage for d3uvea_ (3uve A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108168Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)
  8. 2108169Domain d3uvea_: 3uve A: [186416]
    automated match to d1iy8a_
    complexed with edo, nad, pg4

Details for d3uvea_

PDB Entry: 3uve (more details), 1.55 Å

PDB Description: crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium
PDB Compounds: (A:) Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)

SCOPe Domain Sequences for d3uvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uvea_ c.2.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}
tgrvegkvafvtgaargqgrshavrlaqegadiiavdickpiragvvdtaipastpedla
etadlvkghnrrivtaevdvrdydalkaavdsgveqlgrldiivanagignggdtldkts
eedwtemidinlagvwktvkagvphmiaggrggsiiltssvgglkayphtghyvaakhgv
vglmrafgvelgqhmirvnsvhpthvktpmlhnegtfkmfrpdlenpgpddmapicqmfh
tlpipwvepidisnavlffasdearyitgvtlpidagsclk

SCOPe Domain Coordinates for d3uvea_:

Click to download the PDB-style file with coordinates for d3uvea_.
(The format of our PDB-style files is described here.)

Timeline for d3uvea_: