Lineage for d3utla_ (3utl A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1550125Protein Pepsin(ogen) [50658] (4 species)
  7. 1550128Species Human (Homo sapiens), isoform 3A [TaxId:9606] [50660] (5 PDB entries)
  8. 1550132Domain d3utla_: 3utl A: [186405]
    automated match to d1flha_

Details for d3utla_

PDB Entry: 3utl (more details), 2.61 Å

PDB Description: human pepsin 3b
PDB Compounds: (A:) pepsin a

SCOPe Domain Sequences for d3utla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utla_ b.50.1.2 (A:) Pepsin(ogen) {Human (Homo sapiens), isoform 3A [TaxId: 9606]}
vdeqplenyldmeyfgtigigtpaqdftvvfdtgssnlwvpsvycsslactnhnrfnped
sstyqstsetvsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisssgatpvfdniwnqglvsqdlfsvylsaddqsgsvvifggidssyytgsln
wvpvtvegywqitvdsitmngeaiacaegcqaivdtgtslltgptspianiqsdigasen
sdgdmvvscsaisslpdivftingvqypvppsayilqsegscisgfqgmnlptesgelwi
lgdvfirqyftvfdrannqvglapva

SCOPe Domain Coordinates for d3utla_:

Click to download the PDB-style file with coordinates for d3utla_.
(The format of our PDB-style files is described here.)

Timeline for d3utla_: