Lineage for d1cce__ (1cce -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Cytochrome c peroxidase, CCP [48119] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (71 PDB entries) 
Domain d1cce__: 1cce - [18640]
Details for d1cce__
PDB Entry: 1cce (more details), 2.3 Å
PDB Description: construction of a bis-aquo heme enzyme and replacement with exogenous ligand
SCOP Domain Sequences for d1cce__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cce__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
SCOP Domain Coordinates for d1cce__:
Click to download the PDB-style file with coordinates for d1cce__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cce__:
- d1cce__ first appeared (with stable ids) in SCOP 1.55
- d1cce__ appears in SCOP 1.59
- d1cce__ appears in the current release, SCOPe 2.08, called d1ccea_
View in 3D