Lineage for d3usuc_ (3usu C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042783Species Butea monosperma [TaxId:56060] [189858] (2 PDB entries)
  8. 2042785Domain d3usuc_: 3usu C: [186396]
    automated match to d1g9fa_
    complexed with abu, ca, gol, mn, nag, xyp

Details for d3usuc_

PDB Entry: 3usu (more details), 2.46 Å

PDB Description: Crystal structure of Butea monosperma seed lectin
PDB Compounds: (C:) Lectin alpha chain

SCOPe Domain Sequences for d3usuc_:

Sequence, based on SEQRES records: (download)

>d3usuc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]}
ttntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspini
wdsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnss
yqtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakll
vaalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsf
xxxxxxldlasflvan

Sequence, based on observed residues (ATOM records): (download)

>d3usuc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]}
ttntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspini
wdsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnss
yqtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakll
vaalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsf
ldlasflvan

SCOPe Domain Coordinates for d3usuc_:

Click to download the PDB-style file with coordinates for d3usuc_.
(The format of our PDB-style files is described here.)

Timeline for d3usuc_: