SCOPe 2.05: Domain d3us0d_: 3us0 D:

Lineage for d3us0d_ (3us0 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries)

8. Domain d3us0d_: 3us0 D: [186383]
   automated match to d1gzha_
   protein/DNA complex; complexed with zn

Details for d3us0d_

PDB Entry: 3us0, 2.5 Å

PDB Description: structure of p63 dna binding domain in complex with a 22 base pair a/t rich response element containing a two base pair "at" spacer between half sites

PDB Compounds: (D:) Tumor protein 63

SCOPe Domain Sequences for d3us0d_:

Sequence, based on SEQRES records:

>d3us0d_ b.2.5.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maspsntdypgphsfdvsfqqsstaksatwtystelkklycqiaktcpiqikvmtpppqg
avirampvykkaehvtevvkrcpnhelsrefnegqiappshlirvegnshaqyvedpitg
rqsvlvpyeppqvgtefttvlynfmcnsscvggmnrrpiliivtletrdgqvlgrrcfea
ricacpgrdrkadedsirk

Sequence, based on observed residues (ATOM records):

>d3us0d_ b.2.5.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maspsntdypgphsfdvsfqatwtystelkklycqiaktcpiqikvmtpppqgaviramp
vykkaehvtevvkrcpnhelsrefnegqiappshlirvegnshaqyvedpitgrqsvlvp
yeppqvgtefttvlynfmcnsscvggmnrrpiliivtletrdgqvlgrrcfearicacpg
rdrkadedsirk

Timeline for d3us0d_:

• d3us0d_ first appeared in SCOPe 2.01
  
• d3us0d_ appears in SCOPe 2.04
  
• d3us0d_ is called d3us0d1 in SCOPe 2.06
  
• d3us0d_ appears in the current release, SCOPe 2.08, called d3us0d1