Lineage for d3us0c1 (3us0 C:127-320)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2768088Protein automated matches [190198] (2 species)
    not a true protein
  7. 2768089Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2768196Domain d3us0c1: 3us0 C:127-320 [186382]
    Other proteins in same PDB: d3us0a2, d3us0b2, d3us0c2, d3us0d2
    automated match to d1gzha_
    protein/DNA complex; complexed with zn

Details for d3us0c1

PDB Entry: 3us0 (more details), 2.5 Å

PDB Description: structure of p63 dna binding domain in complex with a 22 base pair a/t rich response element containing a two base pair "at" spacer between half sites
PDB Compounds: (C:) Tumor protein 63

SCOPe Domain Sequences for d3us0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3us0c1 b.2.5.2 (C:127-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psntdypgphsfdvsfqqsstaksatwtystelkklycqiaktcpiqikvmtpppqgavi
rampvykkaehvtevvkrcpnhelsrefnegqiappshlirvegnshaqyvedpitgrqs
vlvpyeppqvgtefttvlynfmcnsscvggmnrrpiliivtletrdgqvlgrrcfearic
acpgrdrkadedsi

SCOPe Domain Coordinates for d3us0c1:

Click to download the PDB-style file with coordinates for d3us0c1.
(The format of our PDB-style files is described here.)

Timeline for d3us0c1: