SCOPe 2.06: Domain d3us0a1: 3us0 A:127-320

Lineage for d3us0a1 (3us0 A:127-320)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d3us0a1: 3us0 A:127-320 [186380]
   Other proteins in same PDB: d3us0a2, d3us0b2, d3us0c2, d3us0d2
   automated match to d1gzha_
   protein/DNA complex; complexed with zn

Details for d3us0a1

PDB Entry: 3us0, 2.5 Å

PDB Description: structure of p63 dna binding domain in complex with a 22 base pair a/t rich response element containing a two base pair "at" spacer between half sites

PDB Compounds: (A:) Tumor protein 63

SCOPe Domain Sequences for d3us0a1:

Sequence; same for both SEQRES and ATOM records:

>d3us0a1 b.2.5.2 (A:127-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psntdypgphsfdvsfqqsstaksatwtystelkklycqiaktcpiqikvmtpppqgavi
rampvykkaehvtevvkrcpnhelsrefnegqiappshlirvegnshaqyvedpitgrqs
vlvpyeppqvgtefttvlynfmcnsscvggmnrrpiliivtletrdgqvlgrrcfearic
acpgrdrkadedsi

Timeline for d3us0a1:

• d3us0a1 first appeared in SCOPe 2.01, called d3us0a_
  
• d3us0a1 was called d3us0a_ in SCOPe 2.05
  
• d3us0a1 appears in SCOPe 2.07
  
• d3us0a1 appears in the current release, SCOPe 2.08