Lineage for d3urrb1 (3urr B:1-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971287Family d.112.1.0: automated matches [191530] (1 protein)
    not a true family
  6. 2971288Protein automated matches [190899] (6 species)
    not a true protein
  7. 2971292Species Burkholderia thailandensis [TaxId:271848] [190015] (1 PDB entry)
  8. 2971294Domain d3urrb1: 3urr B:1-151 [186379]
    Other proteins in same PDB: d3urra2, d3urrb2
    automated match to d1a6jb_
    complexed with gol, po4

Details for d3urrb1

PDB Entry: 3urr (more details), 1.4 Å

PDB Description: Structure of PTS IIA-like nitrogen-regulatory protein PtsN (BTH_I0484) (ptsN)
PDB Compounds: (B:) PTS IIA-like nitrogen-regulatory protein PtsN

SCOPe Domain Sequences for d3urrb1:

Sequence, based on SEQRES records: (download)

>d3urrb1 d.112.1.0 (B:1-151) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mnrlakilplenvviglsvtskkrvfeqaglifenqngiarstvtdnlfarerlgstglg
egvaiphgrikglkhplaafvrlaepipfeapdgqpvsllifllvpeqatqahleilsei
aqllsdrdtrerlhtepdrdelhrlltqwqp

Sequence, based on observed residues (ATOM records): (download)

>d3urrb1 d.112.1.0 (B:1-151) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mnrlakilplenvviglsvtskkrvfeqaglifenqiarstvtdnlfarerlgstglgeg
vaiphgrikglkhplaafvrlaepipfeapdgqpvsllifllvpeqatqahleilseiaq
llsdrdtrerlhtepdrdelhrlltqwqp

SCOPe Domain Coordinates for d3urrb1:

Click to download the PDB-style file with coordinates for d3urrb1.
(The format of our PDB-style files is described here.)

Timeline for d3urrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3urrb2