SCOPe 2.08: Domain d3urra1: 3urr A:1-151

Lineage for d3urra1 (3urr A:1-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
   beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing

4. Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)

5. Family d.112.1.0: automated matches [191530] (1 protein)
   not a true family

6. Protein automated matches [190899] (6 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [190015] (1 PDB entry)

8. Domain d3urra1: 3urr A:1-151 [186378]
   Other proteins in same PDB: d3urra2, d3urrb2
   automated match to d1a6jb_
   complexed with gol, po4

Details for d3urra1

PDB Entry: 3urr, 1.4 Å

PDB Description: Structure of PTS IIA-like nitrogen-regulatory protein PtsN (BTH_I0484) (ptsN)

PDB Compounds: (A:) PTS IIA-like nitrogen-regulatory protein PtsN

SCOPe Domain Sequences for d3urra1:

Sequence; same for both SEQRES and ATOM records:

>d3urra1 d.112.1.0 (A:1-151) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mnrlakilplenvviglsvtskkrvfeqaglifenqngiarstvtdnlfarerlgstglg
egvaiphgrikglkhplaafvrlaepipfeapdgqpvsllifllvpeqatqahleilsei
aqllsdrdtrerlhtepdrdelhrlltqwqp

Timeline for d3urra1:

• d3urra1 first appeared in SCOPe 2.01, called d3urra_
  
• d3urra1 appears in SCOPe 2.07