![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
![]() | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) ![]() |
![]() | Family d.112.1.0: automated matches [191530] (1 protein) not a true family |
![]() | Protein automated matches [190899] (6 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:271848] [190015] (1 PDB entry) |
![]() | Domain d3urra1: 3urr A:1-151 [186378] Other proteins in same PDB: d3urra2, d3urrb2 automated match to d1a6jb_ complexed with gol, po4 |
PDB Entry: 3urr (more details), 1.4 Å
SCOPe Domain Sequences for d3urra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3urra1 d.112.1.0 (A:1-151) automated matches {Burkholderia thailandensis [TaxId: 271848]} mnrlakilplenvviglsvtskkrvfeqaglifenqngiarstvtdnlfarerlgstglg egvaiphgrikglkhplaafvrlaepipfeapdgqpvsllifllvpeqatqahleilsei aqllsdrdtrerlhtepdrdelhrlltqwqp
Timeline for d3urra1: