Lineage for d3ur4b_ (3ur4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066160Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2066198Domain d3ur4b_: 3ur4 B: [186377]
    automated match to d1vyhc1
    complexed with 0bw, cl, edo, so4, unx

Details for d3ur4b_

PDB Entry: 3ur4 (more details), 1.8 Å

PDB Description: crystal structure of human wd repeat domain 5 with compound
PDB Compounds: (B:) WD repeat-containing protein 5

SCOPe Domain Sequences for d3ur4b_:

Sequence, based on SEQRES records: (download)

>d3ur4b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Sequence, based on observed residues (ATOM records): (download)

>d3ur4b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
nppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtggkw
ivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwksd
c

SCOPe Domain Coordinates for d3ur4b_:

Click to download the PDB-style file with coordinates for d3ur4b_.
(The format of our PDB-style files is described here.)

Timeline for d3ur4b_: