Lineage for d3uqnb_ (3uqn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2835970Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)
  8. 2835980Domain d3uqnb_: 3uqn B: [186375]
    automated match to d1dhpa_
    complexed with gol, oxm

Details for d3uqnb_

PDB Entry: 3uqn (more details), 1.94 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Acinetobacter baumannii complexed with Oxamic acid at 1.9 Angstrom resolution
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3uqnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqnb_ c.1.10.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

SCOPe Domain Coordinates for d3uqnb_:

Click to download the PDB-style file with coordinates for d3uqnb_.
(The format of our PDB-style files is described here.)

Timeline for d3uqnb_: