Lineage for d3ccx__ (3ccx -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 445913Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 445926Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 445927Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)
  8. 445981Domain d3ccx__: 3ccx - [18637]

Details for d3ccx__

PDB Entry: 3ccx (more details), 2.3 Å

PDB Description: altering substrate specificity at the heme edge of cytochrome c peroxidase

SCOP Domain Sequences for d3ccx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccx__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdydkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d3ccx__:

Click to download the PDB-style file with coordinates for d3ccx__.
(The format of our PDB-style files is described here.)

Timeline for d3ccx__: