| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species) OPK group; AIRK subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries) |
| Domain d3up2a_: 3up2 A: [186368] automated match to d1ol5a_ complexed with 0c8, edo |
PDB Entry: 3up2 (more details), 2.3 Å
SCOPe Domain Sequences for d3up2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3up2a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
kkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemieg
rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
lkhnpsqrpmlrevlehpwitanssk
Timeline for d3up2a_: