Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Domain d3uolb_: 3uol B: [186367] automated match to d1ol5a_ complexed with 0c7, edo |
PDB Entry: 3uol (more details), 2.4 Å
SCOPe Domain Sequences for d3uolb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uolb_ d.144.1.7 (B:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy chskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemiegrmh dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh npsqrpmlrevlehpwitanssk
Timeline for d3uolb_: