Lineage for d3unzb_ (3unz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [90039] (43 PDB entries)
  8. 1671945Domain d3unzb_: 3unz B: [186354]
    automated match to d1ol5a_
    complexed with 0bz, edo

Details for d3unzb_

PDB Entry: 3unz (more details), 2.8 Å

PDB Description: Aurora A in Complex with RPM1679
PDB Compounds: (B:) Aurora kinase A

SCOPe Domain Sequences for d3unzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unzb_ d.144.1.7 (B:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d3unzb_:

Click to download the PDB-style file with coordinates for d3unzb_.
(The format of our PDB-style files is described here.)

Timeline for d3unzb_: